VIP, human, ovine, porcine, rat

$62.00$95.00

Peptide VIP is a Neuropeptide that is widely distributed in the central and peripheral nervous systems; Peptide VIP is a vasodilator, bronchodilator and smooth muscle relaxant. Peptide VIP modulates the activity of many immune system cell types. VIP is a mitogen for embryonic sympathetic neurons and its neuroprotective actions are mediated by the release of activity-dependent neurotrophic factors from glial cells.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2

 

Sequence (Three-Letter Code):

{His}{Ser}{Asp}{Ala}{Val}{Phe}{Thr}{Asp}{Asn}{Tyr}{Thr}{Arg}{Leu}{Arg}{Lys}{Gln}{Met}{Ala}{Val}{Lys}{Lys}{Tyr}{Leu}{Asn}{Ser}{Ile}{Leu}{Asn}-NH2

 

Molecular Weight:

3325.8

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other