Urocortin III, mouse

$166.00$285.00

Mouse UcnIII is expressed predominantly in regions of the brain known to be involved in stress-related behaviours, and its expression in the hypothalamus increases following restraint.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2

 

Sequence (Three-Letter Code):

{Phe}{Thr}{Leu}{Ser}{Leu}{Asp}{Val}{Pro}{Thr}{Asn}{Ile}{Met}{Asn}{Ile}{Leu}{Phe}{Asn}{Ile}{Asp}{Lys}{Ala}{Lys}{Asn}{Leu}{Arg}{Ala}{Lys}{Ala}{Ala}{Ala}{Asn}{Ala}{Gln}{Leu}{Met}{Ala}{Gln}{Ile}-NH2

 

Molecular Weight:

4173

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other