Secretoneurin, rat

$250.00$395.00

Secretoneurin (Rat) is a neuropeptide generated in brain, adrenal medulla and other endocrine tissues by proteolytic processing of secretogranin II (chromogranin C). The endogenous peptide can enhance dopamine release.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ

 

Sequence (Three-Letter Code):

{Thr}{Asn}{Glu}{Ile}{Val}{Glu}{Glu}{Gln}{Tyr}{Thr}{Pro}{Gln}{Ser}{Leu}{Ala}{Thr}{Leu}{Glu}{Ser}{Val}{Phe}{Gln}{Glu}{Leu}{Gly}{Lys}{Leu}{Thr}{Gly}{Pro}{Ser}{Asn}{Gln}

 

Molecular Weight:

3652

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other