Prolactin Releasing Peptide (1-31), human

$190.00$345.00

Prolactin-releasing peptide is a specific prolactin releasing peptide. It was originally isolated as an endogenous hypothalamic ligand for the hGR3 orphan receptor and has been shown to release prolactin from dispersed pituitaries harvested from lactating female rats and only at very high doses in cycling females. PrRPs have no effect on prolactin production from dispersed pituitary cells harvested from males.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2

 

Sequence (Three-Letter Code):

{Ser}{Arg}{Thr}{His}{Arg}{His}{Ser}{Met}{Glu}{Ile}{Arg}{Thr}{Pro}{Asp}{Ile}{Asn}{Pro}{Ala}{Trp}{Tyr}{Ala}{Ser}{Arg}{Gly}{Ile}{Arg}{Pro}{Val}{Gly}{Arg}{Phe}-NH2

 

Molecular Weight:

3664.2

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other