Peptide YY (PYY), human

$200.00$635.00

Peptide YY (PYY) is mainly found in gastrointestinal tract. It is believed to involve feeding behavior. It is a gut hormone that inhibits both secretin- and cholecystokinin-stimulated pancreatic secretion. This peptide is an endogenous nonselective agonist at NPY receptors.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2

 

Sequence (Three-Letter Code):

{Tyr}{Pro}{Ile}{Lys}{Pro}{Glu}{Ala}{Pro}{Gly}{Glu}{Asp}{Ala}{Ser}{Pro}{Glu}{Glu}{Leu}{Asn}{Arg}{Tyr}{Tyr}{Ala}{Ser}{Leu}{Arg}{His}{Tyr}{Leu}{Asn}{Leu}{Val}{Thr}{Arg}{Gln}{Arg}{Tyr}-NH2

 

Molecular Weight:

4309.8

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

1 mg, 5 mg, Other