Peptide YY (PYY) (3-36), human

$114.00$185.00

Peptide YY (PYY), a novel 36 amino-acid amidated hormone is a component of the complex neuroendocrine control process. This gut hormone (3-36), when infused into subjects, has been shown to reduce food intake in normal-weight and obese individuals. PYY (3-36) infusion also reduces the plasma levels of the hunger-promoting hormone ghrelin. PYY (3-36) levels have been shown to drop pre-meal and then increase post-prandially. In circulation, PYY (3-36) exists in at least two molecular forms: (1-36) and (3-36). PYY (3-36) selectively binds to Y2 receptors, and it has been found in human intestine and circulating blood.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2

 

Sequence (Three-Letter Code):

{Ile}{Lys}{Pro}{Glu}{Ala}{Pro}{Gly}{Glu}{Asp}{Ala}{Ser}{Pro}{Glu}{Glu}{Leu}{Asn}{Arg}{Tyr}{Tyr}{Ala}{Ser}{Leu}{Arg}{His}{Tyr}{Leu}{Asn}{Leu}{Val}{Thr}{Arg}{Gln}{Arg}{Tyr}-NH2

 

Molecular Weight:

4049.5

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other