Pancreatic Polypeptide, human

$81.00$145.00

Pancreatic Polypeptide is an agonist at Y4 neuropeptide Y receptros. Pancreatic polypeptide (PP) is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas. The exact physiologic role of PP in healthy individuals has not been fully defined. It has been shown, however, that pancreatic polypeptide affects the secretion of pancreatic enzymes, water, and electrolytes. Its effect is biphasic in that PP initially enhances secretion and then inhibits secretion. PP increases gastric emptying and gut motility. Pancreatic polypeptide also relaxes the pyloric and ileocecocolic sphincters, the colon, and gallbladder. PP levels increase after ingestion of food and remain elevated from four to eight hours.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2

 

Sequence (Three-Letter Code):

{Ala}{Pro}{Leu}{Glu}{Pro}{Val}{Tyr}{Pro}{Gly}{Asp}{Asn}{Ala}{Thr}{Pro}{Glu}{Gln}{Met}{Ala}{Gln}{Tyr}{Ala}{Ala}{Asp}{Leu}{Arg}{Arg}{Tyr}{Ile}{Asn}{Met}{Leu}{Thr}{Arg}{Pro}{Arg}{Tyr}-NH2

 

Molecular Weight:

4181.7

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other