PACAP (6-38), human, ovine, rat

$133.00$215.00

PACAP (6-38) is a potent antagonist of PACAP 38. PACAP (6-38) is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27-stimulated pituitary adenylate cyclase. Ki values for the inhibition of the enzyme were 7nM and 150 nM, respectively. PACAP (6-38) caused a small but significant (approximately 20%) inhibition of the NANC relaxation due to electrical field stimulation (1 Hz or 10 Hz for 20 s). At these frequencies PACAP (6-38) caused no inhibition of the NANC relaxation in the presence of the P2 purinoceptor antagonist pyridoxal-phosphate-6-azophenyl-2′,4′-disulphonic acid (or PPADS) plus the NO-synthase blocker NG-nitro-L-arginine; in preparations pretreated with L-NOARG alone, PACAP (6-38) retained its inhibitory effect.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2

 

Sequence (Three-Letter Code):

{Phe}{Thr}{Asp}{Ser}{Tyr}{Ser}{Arg}{Tyr}{Arg}{Lys}{Gln}{Met}{Ala}{Val}{Lys}{Lys}{Tyr}{Leu}{Ala}{Ala}{Val}{Leu}{Gly}{Lys}{Arg}{Tyr}{Lys}{Gln}{Arg}{Val}{Lys}{Asn}{Lys}-NH2

 

Molecular Weight:

4024.8

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other