PACAP (1-38), human, ovine, rat

$142.00$255.00

PACAP (1-38), a novel neuropeptide isolated from the bovine hypothalamus is more active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50=7 nM). PACAP 1-38 (10-9 M) increased substance P (SP), gastrin releasing peptide (GRP), and VIP release. PACAP 1-38 (10-8 M) inhibited gastrin secretion and stimulated somatostatin secretion and motility dose-dependently.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2

 

Sequence (Three-Letter Code):

{His}{Ser}{Asp}{Gly}{Ile}{Phe}{Thr}{Asp}{Ser}{Tyr}{Ser}{Arg}{Tyr}{Arg}{Lys}{Gln}{Met}{Ala}{Val}{Lys}{Lys}{Tyr}{Leu}{Ala}{Ala}{Val}{Leu}{Gly}{Lys}{Arg}{Tyr}{Lys}{Gln}{Arg}{Val}{Lys}{Asn}{Lys}-NH2

 

Molecular Weight:

4534.3

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other