PACAP (1-27), human, ovine, rat

$104.00$175.00

PACAP (1-27) (the N-terminal fragment of PACAP-38) is a novel neuropeptides originally isolated from bovine hypothalamus, also found in humans and rats. PACAP (1-27) shows considerable homology with Vasoactive Intestinal Polypeptide (VIP), and can stimulate adenylate cyclase much more potently than VIP. The PACAP(1-27)-induced increase in pancreatic venous blood flow was blocked by PACAP(6-27) but not by atropine. Therefore, the endocrine secretagogue effect of PACAP(1-27) is primarily mediated by the PAC(1) receptor, and that PACAP(1-27) may interact with muscarinic receptor function in PACAP-induced insulin and glucagon secretion in the canine pancreas in vivo.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2

 

Sequence (Three-Letter Code):

{His}{Ser}{Asp}{Gly}{Ile}{Phe}{Thr}{Asp}{Ser}{Tyr}{Ser}{Arg}{Tyr}{Arg}{Lys}{Gln}{Met}{Ala}{Val}{Lys}{Lys}{Tyr}{Leu}{Ala}{Ala}{Val}{Leu}-NH2

 

Molecular Weight:

3147.6

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other