LL37 (Human)

$300.00$495.00

The cathelicidin anti-microbial peptide LL-37 is involved in the reepithelialization of human skin wounds and is lacking in chronic ulcer epithelium. LL-37(human) is a cathelicidin-derived peptide with antimicrobial and angiogenic activity.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

[LL-37, 37 aa]

 

Sequence (Three-Letter Code):

{Leu}{Leu}{Gly}{Asp}{Phe}{Phe}{Arg}{Lys}{Ser}{Lys}{Glu}{Lys}{Ile}{Gly}{Lys}{Glu}{Phe}{Lys}{Arg}{Ile}{Val}{Gln}{Arg}{Ile}{Lys}{Asp}{Phe}{Leu}{Arg}{Asn}{Leu}{Val}{Pro}{Arg}{Thr}{Glu}{Ser}

 

Molecular Weight:

4493.3

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other