LL-37, scrambled

$175.00$565.00

The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). This peptide is the scrambled version.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR

 

Sequence (Three-Letter Code):

{Gly}{Leu}{Lys}{Leu}{Arg}{Phe}{Glu}{Phe}{Ser}{Lys}{Ile}{Lys}{Gly}{Glu}{Phe}{Leu}{Lys}{Thr}{Pro}{Glu}{Val}{Arg}{Phe}{Arg}{Asp}{Ile}{Lys}{Leu}{Lys}{Asp}{Asn}{Arg}{Ile}{Ser}{Val}{Gln}{Arg}

 

Molecular Weight:

4493.3

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

1 mg, 5 mg, Other