Glucagon-Like Peptide (GLP) I (7-36), amide, human

$90.00$155.00

Glucagon-Like Peptide I (7-36) (GLP)-1 (7-36)-NH2 is a peptide found in the mucosal endocrine cells of the intestine, and plasma levels of Glucagon-Like Peptide I (7-36)-NH2 immunoreactivity show a rise after the ingestion of a fat or mixed-component meal. The effects of physiological infusion of Glucagon-Like Peptide I (7-36)-NH2 on a submaximal gastric acid secretion in healthy volunteers at a rate known to mimic the observed postprandial rise in plasma concentrations. Some results suggest a novel role for Glucagon-Like Peptide I (7-36)-NH2 as a physiological inhibitor of gastric acid secretion in humans.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2

 

Sequence (Three-Letter Code):

{His}{Ala}{Glu}{Gly}{Thr}{Phe}{Thr}{Ser}{Asp}{Val}{Ser}{Ser}{Tyr}{Leu}{Glu}{Gly}{Gln}{Ala}{Ala}{Lys}{Glu}{Phe}{Ile}{Ala}{Trp}{Leu}{Val}{Lys}{Gly}{Arg}-NH2

 

Molecular Weight:

3297.5

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other