Exendin (9-39)

$138.00$235.00

Exendin (9-39) is an inverse agonist of the murine glucagon-like peptide-1 receptor. There are implications for basal intracellular cyclic adenosine 3′, 5′-monophosphate levels and beta-cell glucose competence. Exendin (9-39) is a competitive inhibitor of Exendin-3 and Exendin-4. On digestive smooth muscle, exendin (9-39) behaves as an antagonist for two members of the glucagon-receptor family, GLP-1 and glicentin.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2

 

Sequence (Three-Letter Code):

{Asp}{Leu}{Ser}{Lys}{Gln}{Met}{Glu}{Glu}{Glu}{Ala}{Val}{Arg}{Leu}{Phe}{Ile}{Glu}{Trp}{Leu}{Lys}{Asn}{Gly}{Gly}{Pro}{Ser}{Ser}{Gly}{Ala}{Pro}{Pro}{Pro}{Ser}-NH2

 

Molecular Weight:

3369.8

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other