Corticotropin Releasing Factor, ovine

$109.00$185.00

Corticotropin Releasing Factor (CRF) is a hypothalamic peptide that releases ACTH and endorphin from the anterior pituitary. Corticotropin Releasing Factor is also a neurotransitter in the central nervous system, and is involved in autonomic and endocrine responses to stress.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2

 

Sequence (Three-Letter Code):

{Ser}{Gln}{Glu}{Pro}{Pro}{Ile}{Ser}{Leu}{Asp}{Leu}{Thr}{Phe}{His}{Leu}{Leu}{Arg}{Glu}{Val}{Leu}{Glu}{Met}{Thr}{Lys}{Ala}{Asp}{Gln}{Leu}{Ala}{Gln}{Gln}{Ala}{His}{Ser}{Asn}{Arg}{Lys}{Leu}{Leu}{Asp}{Ile}{Ala}-NH2

 

Molecular Weight:

4670.3

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other