Corticotropin Releasing Factor, human, rat

$109.00$185.00

Corticotropin-releasing factor (CRF) has been widely implicated as playing a major role in modulating the endocrine, autonomic, behavioral and immune responses to stress. Corticotropin Releasing Factor (CRF) is a hypothalamic peptide that releases adrenocorticotropic hormone (ACTH) and endorphin from the anterior pituitary. Corticotropin Releasing Factor (CRF) is also a neurotransmitter in the central nervous system, and is involved in autonomic and endocrine responses to stress.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2

 

Sequence (Three-Letter Code):

{Ser}{Glu}{Glu}{Pro}{Pro}{Ile}{Ser}{Leu}{Asp}{Leu}{Thr}{Phe}{His}{Leu}{Leu}{Arg}{Glu}{Val}{Leu}{Glu}{Met}{Ala}{Arg}{Ala}{Glu}{Gln}{Leu}{Ala}{Gln}{Gln}{Ala}{His}{Ser}{Asn}{Arg}{Lys}{Leu}{Met}{Glu}{Ile}{Ile}-NH2

 

Molecular Weight:

4757.5

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other