Cecropin B

$138.00$235.00

Cecropins are produced by insects, particularly under conditions of infection. Cecropins are bioactive peptides that interact with membranes and form transmembrane channels that allow the free flow of electrolytes, metabolites, and water across the phospholipid bilayers. Anti-cecropin B is useful for the detection of cecropin B in various immunological assays. Cecropin B has been modified in some instances by substituting a single amino acid to render the molecule less susceptible to proteolytic cleavage.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2

 

Sequence (Three-Letter Code):

{Lys}{Trp}{Lys}{Val}{Phe}{Lys}{Lys}{Ile}{Glu}{Lys}{Met}{Gly}{Arg}{Asn}{Ile}{Arg}{Asn}{Gly}{Ile}{Val}{Lys}{Ala}{Gly}{Pro}{Ala}{Ile}{Ala}{Val}{Leu}{Gly}{Glu}{Ala}{Lys}{Ala}{Leu}-NH2

 

Molecular Weight:

3834.7

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other