Calcitonin, salmon

$57.00$85.00

Calcitonin (salmon) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes. Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide; that peptide appears to function in the nervous and vascular systems. The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2

 

Sequence (Three-Letter Code):

{Cys}{Ser}{Asn}{Leu}{Ser}{Thr}{Cys}{Val}{Leu}{Gly}{Lys}{Leu}{Ser}{Gln}{Glu}{Leu}{His}{Lys}{Leu}{Gln}{Thr}{Tyr}{Pro}{Arg}{Thr}{Asn}{Thr}{Gly}{Ser}{Gly}{Thr}{Pro}-NH2

 

Molecular Weight:

3431.9

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other