Calcitonin, eel

$155.00$450.00

Calcitonin is hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2

 

Sequence (Three-Letter Code):

{Cys}{Ser}{Asn}{Leu}{Ser}{Thr}{Cys}{Val}{Leu}{Gly}{Lys}{Leu}{Ser}{Gln}{Glu}{Leu}{His}{Lys}{Leu}{Gln}{Thr}{Tyr}{Pro}{Arg}{Thr}{Asp}{Val}{Gly}{Ala}{Gly}{Thr}{Pro}-NH2

 

Molecular Weight:

3414.9

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

1 mg, 5 mg, Other