C34, gp41 HIV Fragment

$297.00$845.00

This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL

 

Sequence (Three-Letter Code):

{Trp}{Met}{Glu}{Trp}{Asp}{Arg}{Glu}{Ile}{Asn}{Asn}{Tyr}{Thr}{Ser}{Leu}{Ile}{His}{Ser}{Leu}{Ile}{Glu}{Glu}{Ser}{Gln}{Asn}{Gln}{Gln}{Glu}{Lys}{Asn}{Glu}{Gln}{Glu}{Leu}{Leu}

 

Molecular Weight:

4248.6

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

1 mg, 5 mg, Other