Brain Natriuretic Peptide (BNP) (1-32), human

$109.00$175.00

Brain natriuretic peptide (type B natriuretic peptide, BNP) was originally isolated from brain, but is mainly produced in myoendocrine cells of the heart ventricles from which it is released into the circulatory system. BNP is involved in blood pressure control and cardiovascular homeostasis.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)

 

Sequence (Three-Letter Code):

{Ser}{Pro}{Lys}{Met}{Val}{Gln}{Gly}{Ser}{Gly}{Cys}{Phe}{Gly}{Arg}{Lys}{Met}{Asp}{Arg}{Ile}{Ser}{Ser}{Ser}{Ser}{Gly}{Leu}{Gly}{Cys}{Lys}{Val}{Leu}{Arg}{Arg}{His}

 

Molecular Weight:

3464.1

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other