beta-Amyloid (40-1), human

$195.00$355.00

Beta amyloid (40-1) is the reverse of beta amyloid (1-42), the latter is a member of beta amyloid-peptides, which are involved in the amyloid beta-peptide (A beta)-associated free radical oxidative stress model for neuronal death in Alzheimer’s disease (AD) brain.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD

 

Sequence (Three-Letter Code):

{Val}{Val}{Gly}{Gly}{Val}{Met}{Leu}{Gly}{Ile}{Ile}{Ala}{Gly}{Lys}{Asn}{Ser}{Gly}{Val}{Asp}{Glu}{Ala}{Phe}{Phe}{Val}{Leu}{Lys}{Gln}{His}{His}{Val}{Glu}{Tyr}{Gly}{Ser}{Asp}{His}{Arg}{Phe}{Glu}{Ala}{Asp}

 

Molecular Weight:

4233.7

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other