beta-Amyloid (1-40), rat

$165.00$295.00

The effect of beta-amyloid-(1-40) was investigated on long-term potentiation of glutamatergic excitatory postsynaptic field potentials recorded in the inner molecular layer in the rat dentate gyrus in vitro. In the presence of 200 nM beta-amyloid-(1-40) there was an increase in long-term potentiation of 51%. Basal synaptic transmission was not affected. These results provide direct evidence that a relatively low concentration of beta-amyloid-(1-40) increases synaptic plasticity.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV

 

Sequence (Three-Letter Code):

{Asp}{Ala}{Glu}{Phe}{Gly}{His}{Asp}{Ser}{Gly}{Phe}{Glu}{Val}{Arg}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}

 

Molecular Weight:

4233.7

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other