beta–Amyloid (1-34)

$130.00$215.00

This is a fragment of beta-amyloid peptide. It has amino acids 1 through 34.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL

 

Sequence (Three-Letter Code):

{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}

 

Molecular Weight:

3787.2

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other