Amylin, chicken. Disulfide bonds (Cys 2-7)

$225.00$375.00

Amylin, a 37-amino acid polypeptide that is structurally related to calcitonin, is secreted from the B cells of the pancreas. Amylin has anoretic effects in rats. Amylin may be responsible for the etiology of insulin resistance of type II diabetes mellitus through its modulation of peripheral effects of insulin. Amylin blocks the activation of glycogen synthase by insulin.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

KCNTATCVTQRLADFLVRSSSNIGAIYSPTNVGSNTY-NH2

 

Sequence (Three-Letter Code):

{Lys}{Cys}{Asn}{Thr}{Ala}{Thr}{Cys}{Val}{Thr}{Gln}{Arg}{Leu}{Ala}{Asp}{Phe}{Leu}{Val]{Arg}{Ser}{Ser}{Ser}{Asn}{Ile}{Gly}{Ala}{Ile}{Tyr]{Ser}{Pro}{Thr}{Asn}{Val}{Gly}{Ser}{Asn}{Thr}{Tyr}-NH2
Molecular Weight:

3950.5

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Removal

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other