Adrenomedullin (AM) (1-52), human

$280.00$495.00

Adrenomedullin (1-52) is a potent hypotensive peptide hormone with some structural similarity to calcitonin gene-related peptide. Adrenomedullin (1-52) has vasodilatory properties.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2

 

Sequence (Three-Letter Code):

{Tyr}{Arg}{Gln}{Ser}{Met}{Asn}{Asn}{Phe}{Gln}{Gly}{Leu}{Arg}{Ser}{Phe}{Gly}{Cys}{Arg}{Phe}{Gly}{Thr}{Cys}{Thr}{Val}{Gln}{Lys}{Leu}{Ala}{His}{Gln}{Ile}{Tyr}{Gln}{Phe}{Thr}{Asp}{Lys}{Asp}{Lys}{Asp}{Asn}{Val}{Ala}{Pro}{Arg}{Ser}{Lys}{Ile}{Ser}{Pro}{Gln}{Gly}{Tyr}-NH2

 

Molecular Weight:

6028.9

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other