Adrenomedullin (1-50), human

$300.00$495.00

Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)

 

Sequence (Three-Letter Code):

{Tyr}{Arg}{Gln}{Ser}{Met}{Asn}{Gln}{Gly}{Ser}{Arg}{Ser}{Thr}{Gly}{Cys}{Arg}{Phe}{Gly}{Thr}{Cys}{Thr}{Met}{Gln}{Lys}{Leu}{Ala}{His}{Gln}{Ile}{Tyr}{Gln}{Phe}{Thr}{Asp}{Lys}{Asp}{Lys}{Asp}{Gly}{Met}{Ala}{Pro}{Arg}{Asn}{Lys}{Ile}{Ser}{Pro}{Gln}{Gly}{Tyr}-NH2 (Disulfide bridge: 14-19)

 

Molecular Weight:

5729.5

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other