Adrenocorticotropic Hormone (ACTH) (1-39), rat

$155.00$210.00

Peptide fragments of ACTH (1-39) were formed during in vitro incubation of the peptide with membrane preparations. ACTH (1-39) were isolated by high pressure liquid chromatography, and peptide fragments of ACTH (1-39) characterized by determination of amino acid composition and NH2- terminal residue.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

SYSMEHFRWGKPVGKKRRPVKVYPNVAENESAEAFPLEF

 

Sequence (Three-Letter Code):

{Ser}{Tyr}{Ser}{Met}{Glu}{His}{Phe}{Arg}{Trp}{Gly}{Lys}{Pro}{Val}{Gly}{Lys}{Lys}{Arg}{Arg}{Pro}{Val}{Lys}{Val}{Tyr}{Pro}{Asn}{Val}{Ala}{Glu}{Asn}{Glu}{Ser}{Ala}{Glu}{Ala}{Phe}{Pro}{Leu}{Glu}{Phe}

 

Molecular Weight:

4582.5

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other