ACTH (7-38), human

$70.00$125.00

Corticotropin-inhibiting peptide (CIP), the 7-38 fragment of human ACTH (1-39), is known to act as an antagonist of ACTH receptors. It does not have any corticosteroidogenic activity.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE

 

Sequence (Three-Letter Code):

{Phe}{Arg}{Trp}{Gly}{Lys}{Pro}{Val}{Gly}{Lys}{Lys}{Arg}{Arg}{Pro}{Val}{Lys}{Val}{Tyr}{Pro}{Asn}{Gly}{Ala}{Glu}{Asp}{Glu}{Ser}{Ala}{Glu}{Ala}{Phe}{Pro}{Leu}{Glu}

 

Molecular Weight:

3659.2

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other