Beta-Endorphin, human

$71.00$235.00

Potent endogenous opioid protein b-Endorphin is derived from propiomelanocortin, b-Endorphin is a protein found in the brain, anterior pituitary, skin, immune system, and other peripheral sites. _-Endorphin is released in response to painful stimuli and b-Endorphin has potent antinociceptive activity mediated through its action on _ receptors in brain and by _ and _ receptors in the spinal cord.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE

 

Sequence (Three-Letter Code):

{Tyr}{Gly}{Gly}{Phe}{Met}{Thr}{Ser}{Glu}{Lys}{Ser}{Gln}{Thr}{Pro}{Leu}{Val}{Thr}{Leu}{Phe}{Lys}{Asn}{Ala}{Ile}{Ile}{Lys}{Asn}{Ala}{Tyr}{Lys}{Lys}{Gly}{Glu}

 

Molecular Weight:

3465.1

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

1 mg, 5 mg, Other