Beta-Endorphin, equine

$95.00$175.00

Endorphin Beta is A substance produced in the brain, especially in the pituitary gland, Endorphin Beta blocks the sensation of pain. Endorphin Beta is produced in response to pain, exercise, and other forms of stress. Endorphin Beta belongs to a group of chemicals called polypeptide hormones.

Clear
Catolog No: N/A Category:

Sequence (One-Letter Code):

YGGFMSSEKSQTPLVTLFKNAIIKNAHKKGQ

 

Sequence (Three-Letter Code):

{Tyr}{Gly}{Gly}{Phe}{Met}{Ser}{Ser}{Glu}{Lys}{Ser}{Gln}{Thr}{Pro}{Leu}{Val}{Thr}{Leu}{Phe}{Lys}{Asn}{Ala}{Ile}{Ile}{Lys}{Asn}{Ala}{His}{Lys}{Lys}{Gly}{Gln}

 

Molecular Weight:

3424

 

Purity:
% Peak Area By HPLC ≥ 95%

 

Salt:
TFA Salt

 

Storage:

Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.

 

Note:

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.

 

Documents:

MSDS

Amount

0.5 mg, 1 mg, Other