beta-Amyloid (1-40), human, ultra pure, TFA removal
Beta-amyloid peptide (beta-APP) is a 40-residue peptide implicated in the pathogenesis of Alzheimer's disease (AD) and aged Down's Syndrome, which is promoted by the acquisition of an additional copy of chromosome 21. The peptide is a proteolytic product of the much larger amyloid precursor protein (APP) encoded by a gene on chromosome 21. The peptide comprises a large extracellular N-terminal domain and a short hydrophobic membrane-spanning domain, followed by a short C-terminal region. Beta-APP both precedes and forms part of the transmembrane region.
Amount:
Catalog No.: N/A
Category: beta-Amyloid
Sequence (One-Letter Code):
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence (Three-Letter Code):
{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val}{His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val}{Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val}{Gly}{Gly}{Val}{Val}
Molecular Weight:
4329.8
Purity:
% Peak Area By HPLC ≥ 98%
Salt:
TFA Removal
Storage:
Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
Note:
This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.